SIVA polyclonal antibody (A01)
  • SIVA polyclonal antibody (A01)

SIVA polyclonal antibody (A01)

Ref: AB-H00010572-A01
SIVA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SIVA.
Información adicional
Size 50 uL
Gene Name SIVA1
Gene Alias CD27BP|SIVA|Siva-1|Siva-2
Gene Description SIVA1, apoptosis-inducing factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRPVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIVA (AAH34562, 1 a.a. ~ 110 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10572

Enviar uma mensagem


SIVA polyclonal antibody (A01)

SIVA polyclonal antibody (A01)