IFI44 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFI44 purified MaxPab rabbit polyclonal antibody (D01P)

IFI44 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010561-D01P
IFI44 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFI44 protein.
Información adicional
Size 100 ug
Gene Name IFI44
Gene Alias MTAP44|p44
Gene Description interferon-induced protein 44
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAVTTRLTRLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKSSFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILCDSLGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFI44 (NP_006408.2, 1 a.a. ~ 444 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10561

Enviar uma mensagem


IFI44 purified MaxPab rabbit polyclonal antibody (D01P)

IFI44 purified MaxPab rabbit polyclonal antibody (D01P)