SLC19A2 monoclonal antibody (M10), clone 5B10
  • SLC19A2 monoclonal antibody (M10), clone 5B10

SLC19A2 monoclonal antibody (M10), clone 5B10

Ref: AB-H00010560-M10
SLC19A2 monoclonal antibody (M10), clone 5B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC19A2.
Información adicional
Size 100 ug
Gene Name SLC19A2
Gene Alias TC1|THT1|THTR1|TRMA
Gene Description solute carrier family 19 (thiamine transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC19A2 (NP_008927.1, 209 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10560
Clone Number 5B10
Iso type IgG2a Kappa

Enviar uma mensagem


SLC19A2 monoclonal antibody (M10), clone 5B10

SLC19A2 monoclonal antibody (M10), clone 5B10