RPP38 polyclonal antibody (A01)
  • RPP38 polyclonal antibody (A01)

RPP38 polyclonal antibody (A01)

Ref: AB-H00010557-A01
RPP38 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPP38.
Información adicional
Size 50 uL
Gene Name RPP38
Gene Alias RP11-455B2.5
Gene Description ribonuclease P/MRP 38kDa subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPP38 (NP_892117, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10557

Enviar uma mensagem


RPP38 polyclonal antibody (A01)

RPP38 polyclonal antibody (A01)