AGPAT1 purified MaxPab mouse polyclonal antibody (B02P)
  • AGPAT1 purified MaxPab mouse polyclonal antibody (B02P)

AGPAT1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010554-B02P
AGPAT1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AGPAT1 protein.
Información adicional
Size 50 ug
Gene Name AGPAT1
Gene Alias 1-AGPAT1|G15|LPAAT-alpha|LPAATA|MGC4007|MGC5423
Gene Description 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AGPAT1 (NP_006402.1, 1 a.a. ~ 283 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10554

Enviar uma mensagem


AGPAT1 purified MaxPab mouse polyclonal antibody (B02P)

AGPAT1 purified MaxPab mouse polyclonal antibody (B02P)