HTATIP2 purified MaxPab mouse polyclonal antibody (B01P)
  • HTATIP2 purified MaxPab mouse polyclonal antibody (B01P)

HTATIP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010553-B01P
HTATIP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HTATIP2 protein.
Información adicional
Size 50 ug
Gene Name HTATIP2
Gene Alias CC3|FLJ26963|SDR44U1|TIP30
Gene Description HIV-1 Tat interactive protein 2, 30kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HTATIP2 (NP_006401.2, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10553

Enviar uma mensagem


HTATIP2 purified MaxPab mouse polyclonal antibody (B01P)

HTATIP2 purified MaxPab mouse polyclonal antibody (B01P)