HTATIP2 polyclonal antibody (A01)
  • HTATIP2 polyclonal antibody (A01)

HTATIP2 polyclonal antibody (A01)

Ref: AB-H00010553-A01
HTATIP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HTATIP2.
Información adicional
Size 50 uL
Gene Name HTATIP2
Gene Alias CC3|FLJ26963|SDR44U1|TIP30
Gene Description HIV-1 Tat interactive protein 2, 30kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTATIP2 (AAH02439, 1 a.a. ~ 242 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10553

Enviar uma mensagem


HTATIP2 polyclonal antibody (A01)

HTATIP2 polyclonal antibody (A01)