AGR2 monoclonal antibody (M05), clone 1C9
  • AGR2 monoclonal antibody (M05), clone 1C9

AGR2 monoclonal antibody (M05), clone 1C9

Ref: AB-H00010551-M05
AGR2 monoclonal antibody (M05), clone 1C9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant AGR2.
Información adicional
Size 50 ug
Gene Name AGR2
Gene Alias AG2|GOB-4|HAG-2|XAG-2
Gene Description anterior gradient homolog 2 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10551
Clone Number 1C9
Iso type IgG2b Kappa

Enviar uma mensagem


AGR2 monoclonal antibody (M05), clone 1C9

AGR2 monoclonal antibody (M05), clone 1C9