Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AGR2 monoclonal antibody (M04A), clone 7E9
Abnova
AGR2 monoclonal antibody (M04A), clone 7E9
Ref: AB-H00010551-M04A
AGR2 monoclonal antibody (M04A), clone 7E9
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant AGR2.
Información adicional
Size
200 uL
Gene Name
AGR2
Gene Alias
AG2|GOB-4|HAG-2|XAG-2
Gene Description
anterior gradient homolog 2 (Xenopus laevis)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
10551
Clone Number
7E9
Iso type
IgG2b Kappa
Enviar uma mensagem
AGR2 monoclonal antibody (M04A), clone 7E9
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*