HBXIP polyclonal antibody (A01)
  • HBXIP polyclonal antibody (A01)

HBXIP polyclonal antibody (A01)

Ref: AB-H00010542-A01
HBXIP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HBXIP.
Información adicional
Size 50 uL
Gene Name HBXIP
Gene Alias MGC71071|XIP
Gene Description hepatitis B virus x interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HBXIP (AAH62619, 83 a.a. ~ 173 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10542

Enviar uma mensagem


HBXIP polyclonal antibody (A01)

HBXIP polyclonal antibody (A01)