BATF polyclonal antibody (A01)
  • BATF polyclonal antibody (A01)

BATF polyclonal antibody (A01)

Ref: AB-H00010538-A01
BATF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BATF.
Información adicional
Size 50 uL
Gene Name BATF
Gene Alias B-ATF|BATF1|SFA-2|SFA2
Gene Description basic leucine zipper transcription factor, ATF-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10538

Enviar uma mensagem


BATF polyclonal antibody (A01)

BATF polyclonal antibody (A01)