UBD monoclonal antibody (M01), clone 7D8
  • UBD monoclonal antibody (M01), clone 7D8

UBD monoclonal antibody (M01), clone 7D8

Ref: AB-H00010537-M01
UBD monoclonal antibody (M01), clone 7D8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBD.
Información adicional
Size 50 ug
Gene Name UBD
Gene Alias FAT10|GABBR1|UBD-3
Gene Description ubiquitin D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYCIGG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBD (NP_006389.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10537
Clone Number 7D8
Iso type IgG2a Kappa

Enviar uma mensagem


UBD monoclonal antibody (M01), clone 7D8

UBD monoclonal antibody (M01), clone 7D8