HYOU1 polyclonal antibody (A02)
  • HYOU1 polyclonal antibody (A02)

HYOU1 polyclonal antibody (A02)

Ref: AB-H00010525-A02
HYOU1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HYOU1.
Información adicional
Size 50 uL
Gene Name HYOU1
Gene Alias DKFZp686N08236|FLJ94899|FLJ97572|Grp170|HSP12A|ORP150
Gene Description hypoxia up-regulated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HYOU1 (NP_006380, 901 a.a. ~ 999 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10525

Enviar uma mensagem


HYOU1 polyclonal antibody (A02)

HYOU1 polyclonal antibody (A02)