CHERP monoclonal antibody (M01), clone 2H5
  • CHERP monoclonal antibody (M01), clone 2H5

CHERP monoclonal antibody (M01), clone 2H5

Ref: AB-H00010523-M01
CHERP monoclonal antibody (M01), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHERP.
Información adicional
Size 50 ug
Gene Name CHERP
Gene Alias DAN16|SCAF6|SRA1
Gene Description calcium homeostasis endoplasmic reticulum protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSNSAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARDEC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHERP (AAH21294.1, 795 a.a. ~ 883 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10523
Clone Number 2H5
Iso type IgG2b Kappa

Enviar uma mensagem


CHERP monoclonal antibody (M01), clone 2H5

CHERP monoclonal antibody (M01), clone 2H5