CHERP purified MaxPab mouse polyclonal antibody (B02P)
  • CHERP purified MaxPab mouse polyclonal antibody (B02P)

CHERP purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010523-B02P
CHERP purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CHERP protein.
Información adicional
Size 50 ug
Gene Name CHERP
Gene Alias DAN16|SCAF6|SRA1
Gene Description calcium homeostasis endoplasmic reticulum protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQLICKQQTPELEPAATMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQEQHLLALRQEQVTAAVAHAVEQQMQKLLEETQLDMNEFDNLLQPIIDTCTKDAISAGKNWMFSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQSPALG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHERP (AAH21294.1, 1 a.a. ~ 884 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10523

Enviar uma mensagem


CHERP purified MaxPab mouse polyclonal antibody (B02P)

CHERP purified MaxPab mouse polyclonal antibody (B02P)