SEMA4F purified MaxPab mouse polyclonal antibody (B01P)
  • SEMA4F purified MaxPab mouse polyclonal antibody (B01P)

SEMA4F purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010505-B01P
SEMA4F purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SEMA4F protein.
Información adicional
Size 50 ug
Gene Name SEMA4F
Gene Alias M-SEMA|PRO2353|SEMAM|SEMAW|m-Sema-M
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEDECHNFVQILAIANASHLLTCGTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSAAVMAGGVLYAATVKNYLGTEPIITRAVGRAEDWIRTDTLPSWLNAPAFVAAVALSPAEWGDEDGDDEIYFFFTETS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEMA4F (ABM86603.1, 1 a.a. ~ 770 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10505

Enviar uma mensagem


SEMA4F purified MaxPab mouse polyclonal antibody (B01P)

SEMA4F purified MaxPab mouse polyclonal antibody (B01P)