CARM1 monoclonal antibody (M03), clone 6G9
  • CARM1 monoclonal antibody (M03), clone 6G9

CARM1 monoclonal antibody (M03), clone 6G9

Ref: AB-H00010498-M03
CARM1 monoclonal antibody (M03), clone 6G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CARM1.
Información adicional
Size 50 ug
Gene Name CARM1
Gene Alias PRMT4
Gene Description coactivator-associated arginine methyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CARM1 (NP_954592, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10498
Clone Number 6G9
Iso type IgG2a Kappa

Enviar uma mensagem


CARM1 monoclonal antibody (M03), clone 6G9

CARM1 monoclonal antibody (M03), clone 6G9