UNC13B polyclonal antibody (A01)
  • UNC13B polyclonal antibody (A01)

UNC13B polyclonal antibody (A01)

Ref: AB-H00010497-A01
UNC13B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UNC13B.
Información adicional
Size 50 uL
Gene Name UNC13B
Gene Alias MGC133279|MGC133280|MUNC13|UNC13|Unc13h2|hmunc13
Gene Description unc-13 homolog B (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SKSNNWAPKYNETFHLLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRSTEEGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UNC13B (NP_006368, 1482 a.a. ~ 1591 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10497

Enviar uma mensagem


UNC13B polyclonal antibody (A01)

UNC13B polyclonal antibody (A01)