STK25 purified MaxPab rabbit polyclonal antibody (D01P)
  • STK25 purified MaxPab rabbit polyclonal antibody (D01P)

STK25 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010494-D01P
STK25 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STK25 protein.
Información adicional
Size 100 ug
Gene Name STK25
Gene Alias DKFZp686J1430|SOK1|YSK1
Gene Description serine/threonine kinase 25 (STE20 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK25 (NP_006365.2, 1 a.a. ~ 426 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10494

Enviar uma mensagem


STK25 purified MaxPab rabbit polyclonal antibody (D01P)

STK25 purified MaxPab rabbit polyclonal antibody (D01P)