CREB3 purified MaxPab rabbit polyclonal antibody (D01P)
  • CREB3 purified MaxPab rabbit polyclonal antibody (D01P)

CREB3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010488-D01P
CREB3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CREB3 protein.
Información adicional
Size 100 ug
Gene Name CREB3
Gene Alias LUMAN|LZIP|MGC15333|MGC19782
Gene Description cAMP responsive element binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,PLA-Ce
Immunogen Prot. Seq MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CREB3 (AAH09402.1, 1 a.a. ~ 371 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10488

Enviar uma mensagem


CREB3 purified MaxPab rabbit polyclonal antibody (D01P)

CREB3 purified MaxPab rabbit polyclonal antibody (D01P)