CAP1 monoclonal antibody (M01), clone 4A2
  • CAP1 monoclonal antibody (M01), clone 4A2

CAP1 monoclonal antibody (M01), clone 4A2

Ref: AB-H00010487-M01
CAP1 monoclonal antibody (M01), clone 4A2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CAP1.
Información adicional
Size 100 ug
Gene Name CAP1
Gene Alias CAP|CAP1-PEN
Gene Description CAP, adenylate cyclase-associated protein 1 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAP1 (AAH13963, 1 a.a. ~ 475 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10487
Clone Number 4A2
Iso type IgG1 Kappa

Enviar uma mensagem


CAP1 monoclonal antibody (M01), clone 4A2

CAP1 monoclonal antibody (M01), clone 4A2