CAP1 polyclonal antibody (A01)
  • CAP1 polyclonal antibody (A01)

CAP1 polyclonal antibody (A01)

Ref: AB-H00010487-A01
CAP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CAP1.
Información adicional
Size 50 uL
Gene Name CAP1
Gene Alias CAP|CAP1-PEN
Gene Description CAP, adenylate cyclase-associated protein 1 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAP1 (AAH13963, 1 a.a. ~ 475 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10487

Enviar uma mensagem


CAP1 polyclonal antibody (A01)

CAP1 polyclonal antibody (A01)