UBE2E3 polyclonal antibody (A01)
  • UBE2E3 polyclonal antibody (A01)

UBE2E3 polyclonal antibody (A01)

Ref: AB-H00010477-A01
UBE2E3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE2E3.
Información adicional
Size 50 uL
Gene Name UBE2E3
Gene Alias UBCH9|UbcM2
Gene Description ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2E3 (NP_006348, 65 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10477

Enviar uma mensagem


UBE2E3 polyclonal antibody (A01)

UBE2E3 polyclonal antibody (A01)