TADA3L monoclonal antibody (M02), clone 3H3
  • TADA3L monoclonal antibody (M02), clone 3H3

TADA3L monoclonal antibody (M02), clone 3H3

Ref: AB-H00010474-M02
TADA3L monoclonal antibody (M02), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TADA3L.
Información adicional
Size 100 ug
Gene Name TADA3L
Gene Alias ADA3|FLJ20221|FLJ21329|hADA3
Gene Description transcriptional adaptor 3 (NGG1 homolog, yeast)-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TADA3L (AAH13433, 1 a.a. ~ 432 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10474
Clone Number 3H3
Iso type IgG2a Kappa

Enviar uma mensagem


TADA3L monoclonal antibody (M02), clone 3H3

TADA3L monoclonal antibody (M02), clone 3H3