ZNF238 monoclonal antibody (M04), clone 4E4
  • ZNF238 monoclonal antibody (M04), clone 4E4

ZNF238 monoclonal antibody (M04), clone 4E4

Ref: AB-H00010472-M04
ZNF238 monoclonal antibody (M04), clone 4E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF238.
Información adicional
Size 100 ug
Gene Name ZNF238
Gene Alias C2H2-171|RP58|TAZ-1|ZBTB18
Gene Description zinc finger protein 238
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF238 (NP_991331.1, 182 a.a. ~ 281 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10472
Clone Number 4E4
Iso type IgG2a Kappa

Enviar uma mensagem


ZNF238 monoclonal antibody (M04), clone 4E4

ZNF238 monoclonal antibody (M04), clone 4E4