FST polyclonal antibody (A01)
  • FST polyclonal antibody (A01)

FST polyclonal antibody (A01)

Ref: AB-H00010468-A01
FST polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant FST.
Información adicional
Size 50 uL
Gene Name FST
Gene Alias FS
Gene Description follistatin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FST (AAH04107, 1 a.a. ~ 344 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10468

Enviar uma mensagem


FST polyclonal antibody (A01)

FST polyclonal antibody (A01)