PIBF1 monoclonal antibody (M01), clone 7A3 View larger

Mouse monoclonal antibody raised against a partial recombinant PIBF1.

AB-H00010464-M01

New product

PIBF1 monoclonal antibody (M01), clone 7A3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PIBF1
Gene Alias C13orf24|KIAA1008|PIBF|RP11-505F3.1
Gene Description progesterone immunomodulatory binding factor 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIBF1 (NP_006337, 660 a.a. ~ 755 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10464
Clone Number 7A3
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant PIBF1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant PIBF1.

Mouse monoclonal antibody raised against a partial recombinant PIBF1.