TACC3 monoclonal antibody (M02), clone 6C4
  • TACC3 monoclonal antibody (M02), clone 6C4

TACC3 monoclonal antibody (M02), clone 6C4

Ref: AB-H00010460-M02
TACC3 monoclonal antibody (M02), clone 6C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TACC3.
Información adicional
Size 50 ug
Gene Name TACC3
Gene Alias ERIC1|MGC117382|MGC133242
Gene Description transforming, acidic coiled-coil containing protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TACC3 (NP_006333, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10460
Clone Number 6C4
Iso type IgG3 Kappa

Enviar uma mensagem


TACC3 monoclonal antibody (M02), clone 6C4

TACC3 monoclonal antibody (M02), clone 6C4