TACC3 polyclonal antibody (A01)
  • TACC3 polyclonal antibody (A01)

TACC3 polyclonal antibody (A01)

Ref: AB-H00010460-A01
TACC3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TACC3.
Información adicional
Size 50 uL
Gene Name TACC3
Gene Alias ERIC1|MGC117382|MGC133242
Gene Description transforming, acidic coiled-coil containing protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TACC3 (NP_006333, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10460

Enviar uma mensagem


TACC3 polyclonal antibody (A01)

TACC3 polyclonal antibody (A01)