MAP3K7IP1 monoclonal antibody (M03), clone 2A12 View larger

Mouse monoclonal antibody raised against a partial recombinant MAP3K7IP1.

AB-H00010454-M03

New product

MAP3K7IP1 monoclonal antibody (M03), clone 2A12

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name MAP3K7IP1
Gene Alias 3'-Tab1|MGC57664|TAB1
Gene Description mitogen-activated protein kinase kinase kinase 7 interacting protein 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K7IP1 (NP_705717.1, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10454
Clone Number 2A12
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant MAP3K7IP1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant MAP3K7IP1.

Mouse monoclonal antibody raised against a partial recombinant MAP3K7IP1.