MAP3K7IP1 monoclonal antibody (M03), clone 2A12
  • MAP3K7IP1 monoclonal antibody (M03), clone 2A12

MAP3K7IP1 monoclonal antibody (M03), clone 2A12

Ref: AB-H00010454-M03
MAP3K7IP1 monoclonal antibody (M03), clone 2A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP3K7IP1.
Información adicional
Size 100 ug
Gene Name MAP3K7IP1
Gene Alias 3'-Tab1|MGC57664|TAB1
Gene Description mitogen-activated protein kinase kinase kinase 7 interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K7IP1 (NP_705717.1, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10454
Clone Number 2A12
Iso type IgG1 Kappa

Enviar uma mensagem


MAP3K7IP1 monoclonal antibody (M03), clone 2A12

MAP3K7IP1 monoclonal antibody (M03), clone 2A12