PPIE polyclonal antibody (A01)
  • PPIE polyclonal antibody (A01)

PPIE polyclonal antibody (A01)

Ref: AB-H00010450-A01
PPIE polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPIE.
Información adicional
Size 50 uL
Gene Name PPIE
Gene Alias CYP-33|MGC111222|MGC3736
Gene Description peptidylprolyl isomerase E (cyclophilin E)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIE (NP_006103, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10450

Enviar uma mensagem


PPIE polyclonal antibody (A01)

PPIE polyclonal antibody (A01)