Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACAA2 monoclonal antibody (M01), clone 5C4
Abnova
ACAA2 monoclonal antibody (M01), clone 5C4
Ref: AB-H00010449-M01
ACAA2 monoclonal antibody (M01), clone 5C4
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACAA2.
Información adicional
Size
100 ug
Gene Name
ACAA2
Gene Alias
DSAEC|FLJ35992|FLJ95265
Gene Description
acetyl-Coenzyme A acyltransferase 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq
SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACAA2 (NP_006102, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10449
Clone Number
5C4
Iso type
IgG1 Kappa
Enviar uma mensagem
ACAA2 monoclonal antibody (M01), clone 5C4
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*