C1D purified MaxPab mouse polyclonal antibody (B01P)
  • C1D purified MaxPab mouse polyclonal antibody (B01P)

C1D purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010438-B01P
C1D purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1D protein.
Información adicional
Size 50 ug
Gene Name C1D
Gene Alias MGC12261|MGC14659|SUNCOR
Gene Description nuclear DNA-binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1D (NP_006324.1, 1 a.a. ~ 141 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10438

Enviar uma mensagem


C1D purified MaxPab mouse polyclonal antibody (B01P)

C1D purified MaxPab mouse polyclonal antibody (B01P)