TESK2 monoclonal antibody (M04), clone 5H4
  • TESK2 monoclonal antibody (M04), clone 5H4

TESK2 monoclonal antibody (M04), clone 5H4

Ref: AB-H00010420-M04
TESK2 monoclonal antibody (M04), clone 5H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TESK2.
Información adicional
Size 100 ug
Gene Name TESK2
Gene Alias -
Gene Description testis-specific kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq GPGTMPLADWQEPLAPPIRRWCSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSGIGLQTQGKQDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TESK2 (AAH33085, 405 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10420
Clone Number 5H4
Iso type IgG1 Kappa

Enviar uma mensagem


TESK2 monoclonal antibody (M04), clone 5H4

TESK2 monoclonal antibody (M04), clone 5H4