Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
YAP1 monoclonal antibody (M01J), clone 2F12
Abnova
YAP1 monoclonal antibody (M01J), clone 2F12
Ref: AB-H00010413-M01J
YAP1 monoclonal antibody (M01J), clone 2F12
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant YAP1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size
100 ug
Gene Name
YAP1
Gene Alias
YAP|YAP2|YAP65|YKI
Gene Description
Yes-associated protein 1, 65kDa
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10413
Clone Number
2F12
Iso type
IgG2a Kappa
Enviar uma mensagem
YAP1 monoclonal antibody (M01J), clone 2F12
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*