YAP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • YAP1 purified MaxPab rabbit polyclonal antibody (D01P)

YAP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010413-D01P
YAP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human YAP1 protein.
Información adicional
Size 100 ug
Gene Name YAP1
Gene Alias YAP|YAP2|YAP65|YKI
Gene Description Yes-associated protein 1, 65kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen YAP1 (AAH38235.1, 1 a.a. ~ 504 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10413

Enviar uma mensagem


YAP1 purified MaxPab rabbit polyclonal antibody (D01P)

YAP1 purified MaxPab rabbit polyclonal antibody (D01P)