RAPGEF3 monoclonal antibody (M01), clone 2E5
  • RAPGEF3 monoclonal antibody (M01), clone 2E5

RAPGEF3 monoclonal antibody (M01), clone 2E5

Ref: AB-H00010411-M01
RAPGEF3 monoclonal antibody (M01), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAPGEF3.
Información adicional
Size 100 ug
Gene Name RAPGEF3
Gene Alias CAMP-GEFI|EPAC|EPAC1|HSU79275|MGC21410|bcm910
Gene Description Rap guanine nucleotide exchange factor (GEF) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAPGEF3 (AAH17728, 772 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10411
Clone Number 2E5
Iso type IgG2a Kappa

Enviar uma mensagem


RAPGEF3 monoclonal antibody (M01), clone 2E5

RAPGEF3 monoclonal antibody (M01), clone 2E5