IFITM3 purified MaxPab mouse polyclonal antibody (B02P)
  • IFITM3 purified MaxPab mouse polyclonal antibody (B02P)

IFITM3 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010410-B02P
IFITM3 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IFITM3 protein.
Información adicional
Size 50 ug
Gene Name IFITM3
Gene Alias 1-8U|IP15
Gene Description interferon induced transmembrane protein 3 (1-8U)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFITM3 (NP_066362.1, 1 a.a. ~ 133 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10410

Enviar uma mensagem


IFITM3 purified MaxPab mouse polyclonal antibody (B02P)

IFITM3 purified MaxPab mouse polyclonal antibody (B02P)