PGCP monoclonal antibody (M06), clone 2F7
  • PGCP monoclonal antibody (M06), clone 2F7

PGCP monoclonal antibody (M06), clone 2F7

Ref: AB-H00010404-M06
PGCP monoclonal antibody (M06), clone 2F7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PGCP.
Información adicional
Size 100 ug
Gene Name PGCP
Gene Alias -
Gene Description plasma glutamate carboxypeptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGCP (AAH20689, 1 a.a. ~ 472 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10404
Clone Number 2F7
Iso type IgG2a Kappa

Enviar uma mensagem


PGCP monoclonal antibody (M06), clone 2F7

PGCP monoclonal antibody (M06), clone 2F7