PGCP purified MaxPab mouse polyclonal antibody (B01P)
  • PGCP purified MaxPab mouse polyclonal antibody (B01P)

PGCP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010404-B01P
PGCP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PGCP protein.
Información adicional
Size 50 ug
Gene Name PGCP
Gene Alias -
Gene Description plasma glutamate carboxypeptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PGCP (NP_057218, 1 a.a. ~ 472 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10404

Enviar uma mensagem


PGCP purified MaxPab mouse polyclonal antibody (B01P)

PGCP purified MaxPab mouse polyclonal antibody (B01P)