KNTC2 monoclonal antibody (M01), clone 1A10
  • KNTC2 monoclonal antibody (M01), clone 1A10

KNTC2 monoclonal antibody (M01), clone 1A10

Ref: AB-H00010403-M01
KNTC2 monoclonal antibody (M01), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KNTC2.
Información adicional
Size 100 ug
Gene Name NDC80
Gene Alias HEC|HEC1|KNTC2|TID3|hsNDC80
Gene Description NDC80 homolog, kinetochore complex component (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KNTC2 (AAH35617, 545 a.a. ~ 642 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10403
Clone Number 1A10
Iso type IgG1 Kappa

Enviar uma mensagem


KNTC2 monoclonal antibody (M01), clone 1A10

KNTC2 monoclonal antibody (M01), clone 1A10