PIAS3 monoclonal antibody (M03), clone 4F12
  • PIAS3 monoclonal antibody (M03), clone 4F12

PIAS3 monoclonal antibody (M03), clone 4F12

Ref: AB-H00010401-M03
PIAS3 monoclonal antibody (M03), clone 4F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIAS3.
Información adicional
Size 100 ug
Gene Name PIAS3
Gene Alias FLJ14651|ZMIZ5
Gene Description protein inhibitor of activated STAT, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq PPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIAS3 (NP_006090, 453 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10401
Clone Number 4F12
Iso type IgG2a Kappa

Enviar uma mensagem


PIAS3 monoclonal antibody (M03), clone 4F12

PIAS3 monoclonal antibody (M03), clone 4F12