PIAS3 polyclonal antibody (A01)
  • PIAS3 polyclonal antibody (A01)

PIAS3 polyclonal antibody (A01)

Ref: AB-H00010401-A01
PIAS3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PIAS3.
Información adicional
Size 50 uL
Gene Name PIAS3
Gene Alias FLJ14651|ZMIZ5
Gene Description protein inhibitor of activated STAT, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIAS3 (NP_006090, 453 a.a. ~ 550 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10401

Enviar uma mensagem


PIAS3 polyclonal antibody (A01)

PIAS3 polyclonal antibody (A01)