DLC1 MaxPab rabbit polyclonal antibody (D01)
  • DLC1 MaxPab rabbit polyclonal antibody (D01)

DLC1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010395-D01
DLC1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DLC1 protein.
Información adicional
Size 100 uL
Gene Name DLC1
Gene Alias ARHGAP7|FLJ21120|HP|STARD12|p122-RhoGAP
Gene Description deleted in liver cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQKTSGQHMIQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLC1 (NP_872584.1, 1 a.a. ~ 1528 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10395

Enviar uma mensagem


DLC1 MaxPab rabbit polyclonal antibody (D01)

DLC1 MaxPab rabbit polyclonal antibody (D01)