NOD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NOD1 purified MaxPab rabbit polyclonal antibody (D01P)

NOD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010392-D01P
NOD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NOD1 protein.
Información adicional
Size 100 ug
Gene Name NOD1
Gene Alias CARD4|CLR7.1|NLRC1
Gene Description nucleotide-binding oligomerization domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVVVNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSLACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFSCFKESDRLCLQDLLF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOD1 (AAH40339.1, 1 a.a. ~ 953 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10392

Enviar uma mensagem


NOD1 purified MaxPab rabbit polyclonal antibody (D01P)

NOD1 purified MaxPab rabbit polyclonal antibody (D01P)