SCML2 monoclonal antibody (M01), clone 1C8
  • SCML2 monoclonal antibody (M01), clone 1C8

SCML2 monoclonal antibody (M01), clone 1C8

Ref: AB-H00010389-M01
SCML2 monoclonal antibody (M01), clone 1C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCML2.
Información adicional
Size 100 ug
Gene Name SCML2
Gene Alias -
Gene Description sex comb on midleg-like 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq AKTESSPSEASQHSMQSPQKTTLILPTQQVRRSSRIKPPGPTAVPKRSSSVKNITPRKKGPNSGKKEKPLPVICSTSAASLKSLTRDRGMLYKDVASGPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCML2 (NP_006080, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10389
Clone Number 1C8
Iso type IgG2a Kappa

Enviar uma mensagem


SCML2 monoclonal antibody (M01), clone 1C8

SCML2 monoclonal antibody (M01), clone 1C8