BPNT1 monoclonal antibody (M01), clone 2E1
  • BPNT1 monoclonal antibody (M01), clone 2E1

BPNT1 monoclonal antibody (M01), clone 2E1

Ref: AB-H00010380-M01
BPNT1 monoclonal antibody (M01), clone 2E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BPNT1.
Información adicional
Size 100 ug
Gene Name BPNT1
Gene Alias PIP
Gene Description 3'(2'), 5'-bisphosphate nucleotidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BPNT1 (NP_006076, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10380
Clone Number 2E1
Iso type IgG1 Kappa

Enviar uma mensagem


BPNT1 monoclonal antibody (M01), clone 2E1

BPNT1 monoclonal antibody (M01), clone 2E1