IRF9 MaxPab rabbit polyclonal antibody (D01)
  • IRF9 MaxPab rabbit polyclonal antibody (D01)

IRF9 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010379-D01
IRF9 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IRF9 protein.
Información adicional
Size 100 uL
Gene Name IRF9
Gene Alias IRF-9|ISGF3|ISGF3G|p48
Gene Description interferon regulatory factor 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSME
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRF9 (NP_006075.3, 1 a.a. ~ 393 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10379

Enviar uma mensagem


IRF9 MaxPab rabbit polyclonal antibody (D01)

IRF9 MaxPab rabbit polyclonal antibody (D01)