KLF2 monoclonal antibody (M08), clone 1D1 View larger

Mouse monoclonal antibody raised against a partial recombinant KLF2.

AB-H00010365-M08

New product

KLF2 monoclonal antibody (M08), clone 1D1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name KLF2
Gene Alias LKLF
Gene Description Kruppel-like factor 2 (lung)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10365
Clone Number 1D1
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant KLF2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant KLF2.

Mouse monoclonal antibody raised against a partial recombinant KLF2.