NPM2 purified MaxPab mouse polyclonal antibody (B01P)
  • NPM2 purified MaxPab mouse polyclonal antibody (B01P)

NPM2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010361-B01P
NPM2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NPM2 protein.
Información adicional
Size 50 ug
Gene Name NPM2
Gene Alias MGC78655
Gene Description nucleophosmin/nucleoplasmin, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NPM2 (NP_877724.1, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10361

Enviar uma mensagem


NPM2 purified MaxPab mouse polyclonal antibody (B01P)

NPM2 purified MaxPab mouse polyclonal antibody (B01P)